LOCUS       1339bp_PCR_prod         1339 bp    DNA     linear   UNK 09-DEC-2014
DEFINITION  Product_568_578
ACCESSION   1339bp 0EftMo1czK1qoiCHBRNwoLJVSE8
VERSION     1339bp 0EftMo1czK1qoiCHBRNwoLJVSE8
KEYWORDS    .
SOURCE      .
  ORGANISM  .
            .
FEATURES             Location/Qualifiers
     misc            1..22
                     /label="568_pCAPsAjiIR"
     primer_bind     1..22
                     /note="568"
                     /ApEinfo_fwdcolor="green"
                     /ApEinfo_revcolor="red"
     misc            1..22
                     /label="568"
     overlap         1..37
                     /note="olp_+ALddA7RDRqA4MsR6S2vDiSMYD0"
                     /ApEinfo_revcolor="#CFCDC8"
                     /ApEinfo_fwdcolor="#CABAB9"
                     /chksum="+ALddA7RDRqA4MsR6S2vDiSMYD0"
     primer_bind     3..22
                     /note="568_pCAPsAjiIR"
                     /ApEinfo_revcolor="red"
                     /ApEinfo_fwdcolor="green"
     misc            32..58
                     /label="549_ScPGI1tpf"
     primer_bind     38..58
                     /note="549_ScPGI1tpf"
                     /ApEinfo_revcolor="red"
                     /ApEinfo_fwdcolor="green"
     gene            308..412
                     /locus_tag="YBR196C-B"
     mRNA            308..412
                     /locus_tag="YBR196C-B"
                     /product="hypothetical protein"
     CDS             308..412
                     /product="hypothetical protein"
                     /GO_component="GO:0005575 - cellular_component [Evidence
                     ND]"
                     /GO_function="GO:0003674 - molecular_function [Evidence
                     ND]"
                     /codon_start=1
                     /locus_tag="YBR196C-B"
                     /note="hypothetical protein; identified by expression
                     profiling and mass spectrometry"
                     /db_xref="SGD:S000028816"
                     /GO_process="GO:0008150 - biological_process [Evidence ND]"
                     /translation="MWVVLSKEKILLKKAYYAKTILFSALVLRGVRGE"
                     /protein_id="DAA07312.1"
     gene            765..914
                     /locus_tag="YBR196C-A"
     mRNA            765..914
                     /locus_tag="YBR196C-A"
                     /product="hypothetical protein"
     CDS             765..914
                     /product="hypothetical protein"
                     /GO_component="GO:0005575 - cellular_component [Evidence
                     ND]"
                     /GO_component="GO:0016021 - integral to membrane [Evidence
                     IEA]"
                     /GO_component="GO:0016020 - membrane [Evidence IEA,IEA]"
                     /GO_function="GO:0003674 - molecular_function [Evidence
                     ND]"
                     /codon_start=1
                     /locus_tag="YBR196C-A"
                     /note="hypothetical protein; identified by fungal homology
                     and RT-PCR"
                     /db_xref="SGD:S000028534"
                     /GO_process="GO:0008150 - biological_process [Evidence ND]"
                     /translation="MSRVYIYPLTVFYFFAIEMSVFCYYNWFYRRNFPYLFRPIFPFLI
                     VLIS"
                     /protein_id="DAA07311.1"
     primer_bind     complement(1017..1037)
                     /note="622_ScPGI1tpr_PacI"
                     /ApEinfo_revcolor="red"
                     /ApEinfo_fwdcolor="green"
     misc            complement(1017..1044)
                     /label="622_ScPGI1tpr_PacI"
     overlap         1098..1339
                     /note="olp_WozPxSoJjWK29v8yQeT4MATRraA"
                     /ApEinfo_revcolor="#C2FDEA"
                     /ApEinfo_fwdcolor="#F5EFC3"
                     /chksum="WozPxSoJjWK29v8yQeT4MATRraA"
     primer_bind     complement(1311..1339)
                     /note="578"
                     /ApEinfo_fwdcolor="green"
                     /ApEinfo_revcolor="red"
     misc            complement(1311..1339)
                     /label="578"
ORIGIN
        1 gtgccatctg tgcagacaaa cgcatcagga tttaaataat tcagttttct gactgagtta
       61 aaaactaatg tagcgacacc acttccattg gtgcctccgt tatttttttt ttgtatgtta
      121 atgctaaata atacaccgct atgtatttca gggcactact tctacacatc aacggtacta
      181 aacatttcgc tcaagatcgg tccgctttca cgtatttgga tgctatgcaa tgttgactat
      241 tcttagtgga taacatgcgg catttcctgg cggctatttg catcgctatg taagtggcaa
      301 tgttcggatg tgggtagtac tttcaaaaga aaaaatatta ctgaagaagg catactacgc
      361 caagactatt ttattctcag cacttgtcct acgtggggtt agaggcgagt aagactttgg
      421 ccccgctgcg gaagcaaaga gaattttgcc atcggacatg ctaccttacg cttatatctc
      481 tcattggaat atcgttttct gattaaaaca cggaagtaag aacttaattc gtttttcgtt
      541 gaactatgtt gtgccagcgt aacattaaaa aagagtgtac aaggccacgt tctgtcaccg
      601 tcagaaaaat atgtcaatga ggcaagaacc gggatggtaa caaaaatcac gatctgggtg
      661 ggtgtgggtg tattggatta taggaagcca cgcgctcaac ctggaattac aggaagctgg
      721 taattttttg ggtttgcaat catcaccatc tgcacgttgt tataatgtcc cgtgtctata
      781 tatatccatt gacggtattc tatttttttg ctattgaaat gagcgttttt tgttactaca
      841 attggtttta cagacggaat tttccctatt tgtttcgtcc catttttcct tttctcattg
      901 ttctcatatc ttaaaaaggt cctttcttca taatcaatgc tttcttttac ttaatatttt
      961 acttgcattc agtgaatttt aatacatatt cctctagtct tgcaaaatcg atttagaatc
     1021 aagataccag cctaaaatta attaatccgg atttacctga atcaattggc gaaatttttt
     1081 gtacgaaatt tcagccactt cacaggcggt tttcgcacgt acccatgcgc tacgttcctg
     1141 gccctcttca aacaggccca gttcgccaat aaaatcaccc tgattcagat aggagaggat
     1201 catttcttta ccctcttcgt ctttgatcag cactgccaca gagcctttaa cgatgtagta
     1261 cagcgtttcc gctttttcac cctggtgaat aagcgtgctc ttggatgggt acttatgaat
     1321 gtggcaatga gacaagaac
//